SARS - CoV - 2 Spike RBD (receptor binding domain), 395 - 430
Name | SARS - CoV - 2 Spike RBD (receptor binding domain), 395 - 430 |
Category | COVID-19 |
One Letter Code | VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT |
Three Letter Code | H - { Val }{ Tyr }{ Ala }{ Asp }{ Ser }{ Phe }{ Val }{ Ile }{ Arg }{ Gly }{ Asp }{ Glu }{ Val }{ Arg }{ Gln }{ Ile }{ Ala }{ Pro }{ Gly }{ Gln }{ Thr }{ Gly }{ Lys }{ Ile }{ Ala }{ Asp }{ Tyr }{ Asn }{ Tyr }{ Lys }{ Leu }{ Pro }{ Asp }{ Asp }{ Phe }{ Thr } - OH |
Molecular Weight | 4063.460 |
Application | COVID-19 |
1. Wan Y, Shang J, et al. Receptor recognition by the novel coronavirus from Wuhan: an analysis based on decade-long structural studies of SARS coronavirus. J Virol. 2020 Mar 17;94(7). |
2. Chen Y, et al. Structure analysis of the receptor binding of 2019-nCoV. Biochem Biophys Res Commun. 2020 Feb 17. |